|   All Languages   
EN   SV   IS   RU   RO   FR   IT   SK   NL   PT   FI   HU   ES   LA   NO   BG   HR   CS   DA   TR   PL   EO   SR   SQ   EL   BS   |   FR   SK   IS   ES   NL   HU   PL   SV   RO   NO   RU   SQ   FI   IT   DA   CS   PT   HR   BG   LA   EO   SR   BS   TR   EL

English-German Dictionary

Online Dictionary English-German: Enter keyword here!
  äöüß...
  Options | Tips | FAQ | Abbreviations

LoginSign Up
Home|New Website|About|Vocab Trainer|Subjects|Users|Forum|Contribute!
« backPage 83 for words starting with N in the English-German dictionarynext page »
EnglishGerman
net yieldReinertrag {m}
net yield Nettoertrag {m}
net zooplanktonNetzzooplankton {n}
[net to catch various types of terrestrial birds]Tyrass {n} [veraltet] [Rsv.]
[net to catch various types of terrestrial birds] Tirass {n}
[net to catch various types of terrestrial birds] Tiraß {n} [alt]
[net to catch various types of terrestrial birds] Tiras {n} [veraltet] [Rsv.]
[net to catch various types of terrestrial birds] Tyras {n} [veraltet] [Rsv.]
(net) equity base Eigenkapitalausstattung {f}
(net) migration gainWanderungsgewinn {m}
(net) operating assets {pl} Geschäftsvermögen {n}
netaholic [sl.] Internetsüchtiger {m}
Netanya Netanja {n}
netballNetzball {m}
netball Korbball {m}
netbook Netbook {n}
netcaster Netcaster {m} [Internetanbieter für Musikprogramme]
netcordNetzroller {m}
net-cord shot [tennis]Netzroller {m} [Tennis]
netfin grouper [Epinephelus miliaris]Netzflossen-Zackenbarsch {m}
net-fishing Fischen {n} [mit Netzen]
netforceAbteilung {f} für Netzkriminalität
netheruntere
nether Unter-
nether land Niemandsland {n} [fig.]
nether regions {pl} Unterwelt {f}
nether regions {pl} [euph.] Intimbereich {m} {n} [Genitalbereich]
nether regions [euph.] Genitalien {pl}
nether regions [euph.] Genitalbereich {m} {n}
Nether Rhine Nederrijn {m}
nether world [spv.]Unterwelt {f}
Netherland [Joseph O'Neill] Niederland
Netherland dwarf [rabbit] Farbenzwerg {m} [Kaninchenrasse]
Netherlander Niederländer {m}
Netherlander [female] Niederländerin {f}
Netherlanders Niederländer {pl}
Netherlandic niederländisch
Netherlandish niederländisch
Netherlands Antillean guilder <ANG, NAƒ, ƒ> Antillen-Gulden {m} <ANG, NAƒ, ƒ>
Netherlands Antilles <.an> Niederländische Antillen {pl}
Netherlands Bach Society [Nederlandse Bachvereniging] Niederländische Bachgesellschaft {f}
Netherlands East IndiesNiederländisch-Ostindien {n}
Netherlands East IndiesNiederländisch-Indien {n}
Netherlands Missionary Society [Nederlandsch Zendeling Genootschap] Niederländische Missionsgesellschaft {f}
nethermost niedrigste
nethermost unterste
Netherton syndrome [Trichorrhexis invaginata] Netherton-Syndrom {n}
netherworld Unterwelt {f}
netherworldTotenwelt {f}
netherworld Totenreich {n}
netherworldHölle {f}
netherworld Jenseits {n}
netherworld Reich {n} der Toten
Nethuns [Etruscan god] Nethuns {m} [etruskische Gottheit]
neticonazole Neticonazol {n}
netilmicin [C21H41N5O7] Netilmicin {n}
netiquetteNetzetikette {f} [Verhaltenskodex im Internet]
netiquette Netiquette {f}
netiquette Netikette {f}
Netivot Netiwot {n}
netizen [coll.]Netzbürger {m} [ugs.]
netleaf / net-leaf willow [Salix reticulata]Netz-Weide / Netzweide {f}
netleaf / net-leaf willow [Salix reticulata] Netzblättrige Weide {f}
net-leavednetzblätterig
net-leaved willow [Salix reticulata]Netz-Weide {f}
net-leaved willow [Salix reticulata]Netzblättrige Weide {f}
netlet [Am.] [ein kleines Fernseh-Network (Senderkette) in den USA ohne Vollprogramm]
netlike netzartig
net-like netzartig
netlist Netzliste {f}
netmakerNetzmacher {m}
netmaker [female]Netzmacherin {f}
net-marked parmelia [Parmelia sulcata] Sulcatflechte {f}
net-marked parmelia [Parmelia sulcata]Sulcat-Blattflechte {f}
net-marked parmelia [Parmelia sulcata] Furchen-Schüsselflechte {f}
netminder [female] [football] [coll.] Torhüterin {f}
netminder [football] [coll.] Schlussmann {m}
netminder [football] [coll.] Tormann {m}
netminder [football] [coll.] Torhüter {m}
net-net <nn, NN> netto-netto <nn, NN>
net-net price Netto-Netto-Preis {m}
netnography Netnographie {f}
netpal [Br.]Internetbekanntschaft {f}
netrinNetrin {n}
netrin receptor Netrinrezeptor {m}
netsNetze {pl}
net-savvyinterneterfahren
netseed lambsquarters {pl} [treated as sg.] [Chenopodium berlandieri]Berlandier-Gänsefuß / Berlandiers Gänsefuß {m}
netseed lambsquarters {pl} [treated as sg.] [Chenopodium berlandieri] Nuttals Gänsefuß {m}
netspeak Netzjargon {m}
net-spinning caddisflies [family Hydropsychidae, order Trichoptera] Hydropsychiden {pl} [Köcherfliegenfamilie]
net-spinning caddisfly larva Hydropsychidenlarve {f}
netsukeNetsuke {pl}
nett [Br.] [spv.] netto
nett [spv.]Netto {n}
nett amount [Br.] [spv.]Nettobetrag {m}
nett weight [Br.] [spv.]Reingewicht {n}
netted netzförmig
netted ins Netz gegangen
netted genetzt
« nervnestnetanetfnetpnetynettnetwnetwnetwneur »
« backPage 83 for words starting with N in the English-German dictionarynext page »
Hint: Double-click next to phrase to retranslate — To translate another word just start typing!

Contribute to the Dictionary: Add a Translation

Do you know German-English translations not listed in this dictionary? Please tell us by entering them here!
Before you submit, please have a look at the guidelines. If you can provide multiple translations, please post one by one. Make sure to provide useful source information. Important: Please also help by verifying other suggestions!

Limited Input Mode
More than 1000 translations are waiting for verification. This means you can only add a new
translation if you log in and review another one first (max. 500 unverified entries per user).
The input form will only work from within the Contribute! section.


more...
German more...
Word Class more...
Subject
Comment
(Source, URL)
New Window

back to top | home© 2002 - 2023 Paul Hemetsberger | contact / privacy
English-German online dictionary developed to help you share your knowledge with others. More information
Contains translations by TU Chemnitz and Mr Honey's Business Dictionary (German-English). Thank you!
Links to this dictionary or to single translations are very welcome! Questions and Answers
Advertisement