|   All Languages   
EN   SV   IS   RU   RO   FR   SK   IT   NL   LA   ES   PT   FI   HU   NO   UK   BG   HR   CS   DA   TR   PL   EO   SR   SQ   EL   BS   |   FR   SK   IS   ES   IT   NL   RO   HU   PL   SV   RU   NO   FI   UK   SQ   DA   CS   PT   HR   BG   LA   EO   SR   BS   TR   EL

English-German Dictionary

Online Dictionary English-German: Enter keyword here!
  äöüß...
  Options | Tips | FAQ | Abbreviations

LoginSign Up
Home|New Website|About|Vocab Trainer|Subjects|Users|Forum|Contribute!
« backPage 147 for words starting with P in the English-German dictionarynext page »
EnglishGerman
pawner Pfandschuldner {m}
pawning verpfändend
pawning Verpfändung {f}
pawningLombardierung {f}
pawning Versatz {m} [Versetzen]
pawnorPfandgeber {m}
pawns [fig.] Schachfiguren {pl} [fig.]
pawnshop Leihhaus {n}
pawnshopPfandhaus {n}
pawnshopPfandleihe {f}
pawnshopPfandl {n} [österr.] [ugs.]
pawnshopsLeihhäuser {pl}
pawpaw [Carica papaya] [papaya]Papaya {f}
pawsTatzen {pl}
paws Pfoten {pl}
paws [coll.] [hands]Griffel {pl} [salopp] [Finger, Hände]
Paws off!Pfoten weg!
pax Friede {m}
pax [coll.]Pax {pl} [Fluggäste]
pax [coll.] Passagiere {pl} [Fluggäste]
pax [coll.] [usually pl.]Passagier {m} [Fluggast]
pax [coll.] [usually pl.] Pax {m} [Fluggast]
Pax Imperia: Eminent Domain Pax Imperia: Die Sternenkolonie
PAXgene ™ tube PAXgene-Röhrchen / PaxGene-Röhrchen {n} [PAXgene ™]
paxite [Cu2As3]Paxit {m}
pay Entlohnung {f}
payBezahlung {f}
pay Lohn {m} [Arbeitsentgelt]
payVergütung {f}
paySold {m}
pay Heuer {f}
pay Besoldung {f}
pay Arbeitsentgelt {n}
pay {sg}Löhne und Gehälter {pl}
pay accountLohnkonto {n}
pay advice Zahlungsmitteilung {f}
pay agreement Tarifvereinbarung {f}
pay agreementTarifvertrag {m}
pay and allowances Gehalt und Zuwendungen
pay and display [Br.] [car parks]Parken {n} mit Parkschein
pay and display ticket Parkschein {m}
pay and display ticket Parkticket {n}
pay and display ticket machine Parkscheinautomat {m}
pay and perks [coll.] [for MP's] Diäten und Vergünstigungen {pl} [für Abgeordnete]
pay arrearsLohnrückstände {pl}
pay as paidZug-um-Zug-Zahlung {f}
Pay as you drive. <PAYD> Bezahle, wie du fährst.
pay as you earn Quellenabzugsverfahren {n}
pay as you earn <PAYE> [Br.] Quellenabzugsverfahren {n} [Steuerabzug vom Lohn]
pay as you go [Am.] Lohnabzugsverfahren {n}
Pay attention! Aufgepasst!
Pay attention! Passen Sie auf! [formelle Anrede]
Pay attention! [said to two or more people] Gebt fein acht!
Pay attention! [said to two or more people] Passt auf!
pay back Rückzahlung {f}
pay bargainingTarifverhandlung {f}
pay bedPrivatbett {n} im Krankenhaus
pay book Soldbuch {n}
pay booth Kassenhäuschen {n}
pay booths Kassenhäuschen {pl}
pay bracket Besoldungsgruppe {f}
pay bump [coll.] Gehaltserhöhung {f}
pay cap Gehaltsdeckelung {f}
pay channel Bezahlkanal {m}
pay check Lohnscheck {m}
pay check [Am.]Gehaltsscheck {m}
pay cheque [Br.]Lohnscheck {m}
pay cheque [Br.] Lohnzahlung {f}
pay cheque [Br.]Gehaltsscheck {m}
pay claim Lohnforderung {f}
pay claim Gehaltsforderung {f}
Pay close attention! Passen Sie gut auf! [formelle Anrede]
pay code Lohnschlüssel {m}
pay cutGehaltskürzung {f}
pay cut Lohnkürzung {f}
pay dayAbrechnungstag {m}
pay dayLiquidationstag {m}
pay daydingsdaLiquidationstag {m}
pay dayZahltag {m}
pay deal Tarifabschluß {m} [alt]
pay deal [Br.] [coll.] [collective agreement]Gehaltsabkommen {n}
pay demandLohnforderung {f}
pay demandGehaltsforderung {f}
pay dirt [Am.]abbauwürdiges Erzlager {n}
pay dirt [coll.]Quelle {f} von Erfolg / Reichtum
pay dispute Tarifkonflikt {m}
pay dispute Tarifstreit {m}
pay divide Einkommenskluft {f}
pay driverBezahlfahrer {m} [Motorsport]
pay envelopeLohntüte {f}
pay equity Entgeltgleichheit {f}
pay equity act Entgeltgleichheitsgesetz {n}
pay freeze Nullrunde {f}
pay freezeLohnstopp {m}
pay gapLohnkluft {f}
pay gap Lohngefälle {n}
pay gapGehaltsschere {f}
pay gapVerdienstunterschied {m} [Gehaltsunterschied]
pay grade Gehaltsklasse {f}
pay grade [Am.] Besoldungsklasse {f}
« pattPattPaulpavapavipawnpaygpayapayipaympaym »
« backPage 147 for words starting with P in the English-German dictionarynext page »
Hint: Double-click next to phrase to retranslate — To translate another word just start typing!

Add a translation to the English-German dictionary

Do you know German-English translations not listed in this dictionary? Please tell us by entering them here!
Before you submit, please have a look at the guidelines. If you can provide multiple translations, please post one by one. Make sure to provide useful source information. Important: Please also help by verifying other suggestions!

Limited Input Mode
More than 1000 translations are waiting for verification. This means you can only add a new
translation if you log in and review another one first (max. 500 unverified entries per user).
The input form will only work from within the Contribute! section.


more...
German more...
Word Class more...
Subject
Comment
(Source, URL)
Similar

New Window

back to top | home© 2002 - 2025 Paul Hemetsberger | Contact / Privacy | Cookie Settings
English-German dictionary developed to help you share your knowledge with others. More information
Contains translations by TU Chemnitz and Mr Honey's Business Dictionary (German-English). Thank you!
Links to this dictionary or to single translations are very welcome! Questions and Answers
Advertisement